SCOP 1.67: Domain d1hg5a1: 1hg5 A:150-281

Lineage for d1hg5a1 (1hg5 A:150-281)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.7: Spectrin repeat-like [46965] (9 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.8: GAT-like domain [89009] (2 families)

5. Family a.7.8.2: Phosphoinositide-binding clathrin adaptor, domain 2 [100929] (2 proteins)
   this domain is associated with the N-terminal ENTH-like domain

6. Protein Clathrin assembly lymphoid myeloid leukaemia protein, Calm [100930] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [100931] (4 PDB entries)

8. Domain d1hg5a1: 1hg5 A:150-281 [90360]
   Other proteins in same PDB: d1hg5a2
   complexed with ihp

Details for d1hg5a1

PDB Entry: 1hg5, 2 Å

PDB Description: calm-n n-terminal domain of clathrin assembly lymphoid myeloid leukaemia protein, inositol(1,2,3,4,5,6)p6 complex

SCOP Domain Sequences for d1hg5a1:

Sequence; same for both SEQRES and ATOM records:

>d1hg5a1 a.7.8.2 (A:150-281) Clathrin assembly lymphoid myeloid leukaemia protein, Calm {Rat (Rattus norvegicus)}
rgadgvmrtmntekllktvpiiqnqmdalldfnvnsneltngvinaafmllfkdairlfa
aynegiinllekyfdmkknqckegldiykkfltrmtriseflkvaeqvgidrgdipdlsq
apsslldaleqh

Timeline for d1hg5a1:

• d1hg5a1 is new in SCOP 1.67
  
• d1hg5a1 appears in SCOP 1.69
  
• d1hg5a1 appears in the current release, SCOPe 2.08