![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) ![]() |
![]() | Family a.118.9.3: Phosphoinositide-binding clathrin adaptor, N-terminal domain [100911] (2 proteins) |
![]() | Protein Clathrin assembly lymphoid myeloid leukaemia protein, Calm [100912] (1 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [100913] (4 PDB entries) |
![]() | Domain d1hg2a2: 1hg2 A:19-149 [90359] Other proteins in same PDB: d1hg2a1 complex with inositol(4,5)p2 complexed with ip2 |
PDB Entry: 1hg2 (more details), 2 Å
SCOPe Domain Sequences for d1hg2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hg2a2 a.118.9.3 (A:19-149) Clathrin assembly lymphoid myeloid leukaemia protein, Calm {Norway rat (Rattus norvegicus) [TaxId: 10116]} gsavsktvckattheimgpkkkhldyliqctnemnvnipqladslferttnsswvvvfks litthhlmvygnerfiqylasrntlfnlsnfldksglqgydmstfirrysrylnekavsy rqvafdftkvk
Timeline for d1hg2a2: