![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) ![]() |
![]() | Family a.118.9.3: Phosphoinositide-binding clathrin adaptor, N-terminal domain [100911] (2 proteins) |
![]() | Protein Clathrin assembly lymphoid myeloid leukaemia protein, Calm [100912] (1 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [100913] (4 PDB entries) |
![]() | Domain d1hfaa2: 1hfa A:19-149 [90357] Other proteins in same PDB: d1hfaa1 complexed with pio |
PDB Entry: 1hfa (more details), 2 Å
SCOPe Domain Sequences for d1hfaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hfaa2 a.118.9.3 (A:19-149) Clathrin assembly lymphoid myeloid leukaemia protein, Calm {Norway rat (Rattus norvegicus) [TaxId: 10116]} gsavsktvckattheimgpkkkhldyliqctnemnvnipqladslferttnsswvvvfks litthhlmvygnerfiqylasrntlfnlsnfldksglqgydmstfirrysrylnekavsy rqvafdftkvk
Timeline for d1hfaa2: