SCOPe 2.06: Domain d1hf8a1: 1hf8 A:150-281

Lineage for d1hf8a1 (1hf8 A:150-281)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.8: GAT-like domain [89009] (3 families)

5. Family a.7.8.2: Phosphoinositide-binding clathrin adaptor, domain 2 [100929] (2 proteins)
   this domain is associated with the N-terminal ENTH-like domain

6. Protein Clathrin assembly lymphoid myeloid leukaemia protein, Calm [100930] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [100931] (4 PDB entries)

8. Domain d1hf8a1: 1hf8 A:150-281 [90354]
   Other proteins in same PDB: d1hf8a2

Details for d1hf8a1

PDB Entry: 1hf8, 2 Å

PDB Description: calm-n n-terminal domain of clathrin assembly lymphoid myeloid leukaemia protein

PDB Compounds: (A:) clathrin assembly protein short form

SCOPe Domain Sequences for d1hf8a1:

Sequence; same for both SEQRES and ATOM records:

>d1hf8a1 a.7.8.2 (A:150-281) Clathrin assembly lymphoid myeloid leukaemia protein, Calm {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rgadgvmrtmntekllktvpiiqnqmdalldfnvnsneltngvinaafmllfkdairlfa
aynegiinllekyfdmkknqckegldiykkfltrmtriseflkvaeqvgidrgdipdlsq
apsslldaleqh

Timeline for d1hf8a1:

• d1hf8a1 first appeared in SCOP 1.67
  
• d1hf8a1 appears in SCOPe 2.05
  
• d1hf8a1 appears in SCOPe 2.07
  
• d1hf8a1 appears in the current release, SCOPe 2.08