SCOPe 2.06: Domain d1fvjb_: 1fvj B:

Lineage for d1fvjb_ (1fvj B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.13: DsbA-like [100953] (4 proteins)
   contains an all-alpha subdomain insertion

6. Protein Disulfide-bond formation facilitator (DsbA) [100954] (4 species)
   the insert subdomain is a 4-helical bundle

7. Species Escherichia coli [TaxId:562] [100955] (17 PDB entries)

8. Domain d1fvjb_: 1fvj B: [90350]
   mutant

Details for d1fvjb_

PDB Entry: 1fvj, 2.06 Å

PDB Description: the 2.06 angstrom structure of the h32y mutant of the disulfide bond formation protein (dsba)

PDB Compounds: (B:) disulfide bond formation protein

SCOPe Domain Sequences for d1fvjb_:

Sequence; same for both SEQRES and ATOM records:

>d1fvjb_ c.47.1.13 (B:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]}
aqyedgkqyttlekpvagapqvleffsffcpycyqfeevlhisdnvkkklpegvkmtkyh
vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
tvkylsek

Timeline for d1fvjb_:

• d1fvjb_ first appeared in SCOP 1.67
  
• d1fvjb_ appears in SCOPe 2.05
  
• d1fvjb_ appears in SCOPe 2.07
  
• d1fvjb_ appears in the current release, SCOPe 2.08