Lineage for d1dsbb_ (1dsb B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1854195Family c.47.1.13: DsbA-like [100953] (4 proteins)
    contains an all-alpha subdomain insertion
  6. 1854196Protein Disulfide-bond formation facilitator (DsbA) [100954] (3 species)
    the insert subdomain is a 4-helical bundle
  7. 1854197Species Escherichia coli [TaxId:562] [100955] (15 PDB entries)
  8. 1854205Domain d1dsbb_: 1dsb B: [90348]

Details for d1dsbb_

PDB Entry: 1dsb (more details), 2 Å

PDB Description: crystal structure of the dsba protein required for disulphide bond formation in vivo
PDB Compounds: (B:) dsba

SCOPe Domain Sequences for d1dsbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dsbb_ c.47.1.13 (B:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]}
aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
tvkylsek

SCOPe Domain Coordinates for d1dsbb_:

Click to download the PDB-style file with coordinates for d1dsbb_.
(The format of our PDB-style files is described here.)

Timeline for d1dsbb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dsba_