Lineage for d1dkza1 (1dkz A:507-603)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2310325Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2310593Superfamily a.8.4: Heat shock protein 70kD (HSP70), C-terminal subdomain [100934] (2 families) (S)
  5. 2310594Family a.8.4.1: Heat shock protein 70kD (HSP70), C-terminal subdomain [100935] (3 proteins)
  6. 2310598Protein DnaK [100936] (2 species)
  7. 2310599Species Escherichia coli [TaxId:562] [100937] (3 PDB entries)
  8. 2310600Domain d1dkza1: 1dkz A:507-603 [90345]
    Other proteins in same PDB: d1dkza2
    complexed with peptide, chain B
    protein/DNA complex

Details for d1dkza1

PDB Entry: 1dkz (more details), 2 Å

PDB Description: the substrate binding domain of dnak in complex with a substrate peptide, determined from type 1 native crystals
PDB Compounds: (A:) substrate binding domain of dnak

SCOPe Domain Sequences for d1dkza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dkza1 a.8.4.1 (A:507-603) DnaK {Escherichia coli [TaxId: 562]}
lnedeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdklpaddktaie
saltaletalkgedkaaieakmqelaqvsqklmeiaq

SCOPe Domain Coordinates for d1dkza1:

Click to download the PDB-style file with coordinates for d1dkza1.
(The format of our PDB-style files is described here.)

Timeline for d1dkza1: