SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1dkyb1 (1dky B:507-591)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1985633Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 1985814Superfamily a.8.4: Heat shock protein 70kD (HSP70), C-terminal subdomain [100934] (2 families) (S)
  5. 1985815Family a.8.4.1: Heat shock protein 70kD (HSP70), C-terminal subdomain [100935] (3 protein domains)
  6. 1985819Protein DnaK [100936] (2 species)
  7. 1985820Species Escherichia coli [TaxId:562] [100937] (3 PDB entries)
  8. 1985824Domain d1dkyb1: 1dky B:507-591 [90343]
    Other proteins in same PDB: d1dkya2, d1dkyb2

Details for d1dkyb1

PDB Entry: 1dky (more details), 2.8 Å

PDB Description: the substrate binding domain of dnak in complex with a substrate peptide, determined from type 2 native crystals
PDB Compounds: (B:) dnak

SCOPe Domain Sequences for d1dkyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dkyb1 a.8.4.1 (B:507-591) DnaK {Escherichia coli [TaxId: 562]}
lnedeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdklpaddktaie
saltaletalkgedkaaieakmqel

SCOPe Domain Coordinates for d1dkyb1:

Click to download the PDB-style file with coordinates for d1dkyb1.
(The format of our PDB-style files is described here.)

Timeline for d1dkyb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dkyb2