Lineage for d1dkya2 (1dky A:389-506)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 383472Fold b.130: Heat shock protein 70kD (HSP70), peptide-binding domain [100919] (1 superfamily)
    beta-sandwich: 8 strands in 2 sheets
  4. 383473Superfamily b.130.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100920] (1 family) (S)
  5. 383474Family b.130.1.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100921] (1 protein)
  6. 383475Protein DnaK [100922] (2 species)
  7. 383476Species Escherichia coli [TaxId:562] [100923] (7 PDB entries)
  8. 383479Domain d1dkya2: 1dky A:389-506 [90342]
    Other proteins in same PDB: d1dkya1, d1dkyb1

Details for d1dkya2

PDB Entry: 1dky (more details), 2.8 Å

PDB Description: the substrate binding domain of dnak in complex with a substrate peptide, determined from type 2 native crystals

SCOP Domain Sequences for d1dkya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dkya2 b.130.1.1 (A:389-506) DnaK {Escherichia coli}
vllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavsihvlqgerkra
adnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkitikassg

SCOP Domain Coordinates for d1dkya2:

Click to download the PDB-style file with coordinates for d1dkya2.
(The format of our PDB-style files is described here.)

Timeline for d1dkya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dkya1