![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
![]() | Superfamily a.8.4: Heat shock protein 70kD (HSP70), C-terminal subdomain [100934] (2 families) ![]() |
![]() | Family a.8.4.1: Heat shock protein 70kD (HSP70), C-terminal subdomain [100935] (3 proteins) |
![]() | Protein DnaK [100936] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [100937] (3 PDB entries) |
![]() | Domain d1dkya1: 1dky A:507-599 [90341] Other proteins in same PDB: d1dkya2, d1dkyb2 |
PDB Entry: 1dky (more details), 2.8 Å
SCOPe Domain Sequences for d1dkya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dkya1 a.8.4.1 (A:507-599) DnaK {Escherichia coli [TaxId: 562]} lnedeiqkmvrdaeanaeadrkfeelvqtrnqgdhllhstrkqveeagdklpaddktaie saltaletalkgedkaaieakmqelaqvsqklm
Timeline for d1dkya1: