SCOPe 2.03: Domain d1dkxa2: 1dkx A:389-506

Lineage for d1dkxa2 (1dkx A:389-506)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.130: Heat shock protein 70kD (HSP70), peptide-binding domain [100919] (1 superfamily)
   beta-sandwich: 8 strands in 2 sheets

4. Superfamily b.130.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100920] (1 family)

5. Family b.130.1.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100921] (3 proteins)

6. Protein DnaK [100922] (3 species)

7. Species Escherichia coli [TaxId:562] [100923] (7 PDB entries)

8. Domain d1dkxa2: 1dkx A:389-506 [90340]
   Other proteins in same PDB: d1dkxa1
   complexed with peptide, chain B
   protein/DNA complex

Details for d1dkxa2

PDB Entry: 1dkx, 2 Å

PDB Description: the substrate binding domain of dnak in complex with a substrate peptide, determined from type 1 selenomethionyl crystals

PDB Compounds: (A:) substrate binding domain of dnak

SCOPe Domain Sequences for d1dkxa2:

Sequence; same for both SEQRES and ATOM records:

>d1dkxa2 b.130.1.1 (A:389-506) DnaK {Escherichia coli [TaxId: 562]}
vllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavtihvlqgerkra
adnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkitikassg

Timeline for d1dkxa2:

• d1dkxa2 first appeared in SCOP 1.67
  
• d1dkxa2 appears in SCOPe 2.02
  
• d1dkxa2 appears in SCOPe 2.04
  
• d1dkxa2 appears in the current release, SCOPe 2.08