Lineage for d1dkxa2 (1dkx A:389-506)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 569951Fold b.130: Heat shock protein 70kD (HSP70), peptide-binding domain [100919] (1 superfamily)
    beta-sandwich: 8 strands in 2 sheets
  4. 569952Superfamily b.130.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100920] (1 family) (S)
  5. 569953Family b.130.1.1: Heat shock protein 70kD (HSP70), peptide-binding domain [100921] (2 proteins)
  6. 569957Protein DnaK [100922] (2 species)
  7. 569958Species Escherichia coli [TaxId:562] [100923] (7 PDB entries)
  8. 569960Domain d1dkxa2: 1dkx A:389-506 [90340]
    Other proteins in same PDB: d1dkxa1
    complexed with peptide, chain B

Details for d1dkxa2

PDB Entry: 1dkx (more details), 2 Å

PDB Description: the substrate binding domain of dnak in complex with a substrate peptide, determined from type 1 selenomethionyl crystals

SCOP Domain Sequences for d1dkxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dkxa2 b.130.1.1 (A:389-506) DnaK {Escherichia coli}
vllldvtplslgietmggvmttliaknttiptkhsqvfstaednqsavtihvlqgerkra
adnkslgqfnldginpaprgmpqievtfdidadgilhvsakdknsgkeqkitikassg

SCOP Domain Coordinates for d1dkxa2:

Click to download the PDB-style file with coordinates for d1dkxa2.
(The format of our PDB-style files is described here.)

Timeline for d1dkxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dkxa1