![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
![]() | Superfamily a.8.4: Heat shock protein 70kD (HSP70), C-terminal subdomain [100934] (1 family) ![]() |
![]() | Family a.8.4.1: Heat shock protein 70kD (HSP70), C-terminal subdomain [100935] (3 proteins) |
![]() | Protein DnaK [100936] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [100937] (3 PDB entries) |
![]() | Domain d1dkxa1: 1dkx A:507-607 [90339] Other proteins in same PDB: d1dkxa2 complexed with peptide, chain B protein/DNA complex |
PDB Entry: 1dkx (more details), 2 Å
SCOPe Domain Sequences for d1dkxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dkxa1 a.8.4.1 (A:507-607) DnaK {Escherichia coli [TaxId: 562]} lnedeiqkmvrdaeanaeadrkfdelvqtrnqgdhllhstrkqveeagdklpaddktaie saltaletalkgedkaaieakmqelaqvsqklmeiaqqqha
Timeline for d1dkxa1: