Lineage for d1dkxa1 (1dkx A:507-607)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1261719Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 1261863Superfamily a.8.4: Heat shock protein 70kD (HSP70), C-terminal subdomain [100934] (1 family) (S)
  5. 1261864Family a.8.4.1: Heat shock protein 70kD (HSP70), C-terminal subdomain [100935] (3 proteins)
  6. 1261868Protein DnaK [100936] (2 species)
  7. 1261869Species Escherichia coli [TaxId:562] [100937] (3 PDB entries)
  8. 1261871Domain d1dkxa1: 1dkx A:507-607 [90339]
    Other proteins in same PDB: d1dkxa2
    complexed with peptide, chain B
    protein/DNA complex

Details for d1dkxa1

PDB Entry: 1dkx (more details), 2 Å

PDB Description: the substrate binding domain of dnak in complex with a substrate peptide, determined from type 1 selenomethionyl crystals
PDB Compounds: (A:) substrate binding domain of dnak

SCOPe Domain Sequences for d1dkxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dkxa1 a.8.4.1 (A:507-607) DnaK {Escherichia coli [TaxId: 562]}
lnedeiqkmvrdaeanaeadrkfdelvqtrnqgdhllhstrkqveeagdklpaddktaie
saltaletalkgedkaaieakmqelaqvsqklmeiaqqqha

SCOPe Domain Coordinates for d1dkxa1:

Click to download the PDB-style file with coordinates for d1dkxa1.
(The format of our PDB-style files is described here.)

Timeline for d1dkxa1: