Lineage for d1dj0b_ (1dj0 B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2615008Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 2615009Superfamily d.265.1: Pseudouridine synthase [55120] (5 families) (S)
    the active site is the most conserved structural region of the superfamily and is located between the subdomains
  5. 2615010Family d.265.1.1: Pseudouridine synthase I TruA [55121] (1 protein)
  6. 2615011Protein Pseudouridine synthase I TruA [55122] (1 species)
  7. 2615012Species Escherichia coli [TaxId:562] [55123] (4 PDB entries)
  8. 2615014Domain d1dj0b_: 1dj0 B: [90338]
    complexed with cl

Details for d1dj0b_

PDB Entry: 1dj0 (more details), 1.5 Å

PDB Description: the crystal structure of e. coli pseudouridine synthase i at 1.5 angstrom resolution
PDB Compounds: (B:) pseudouridine synthase I

SCOPe Domain Sequences for d1dj0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dj0b_ d.265.1.1 (B:) Pseudouridine synthase I TruA {Escherichia coli [TaxId: 562]}
ppvykialgieydgskyygwqrqnevrsvqeklekalsqvanepitvfcagrtdagvhgt
gqvvhfettalrkdaawtlgvnanlpgdiavrwvktvpddfharfsatarryryiiynhr
lrpavlskgvthfyepldaermhraaqcllgendftsfravqcqsrtpwrnvmhinvtrh
gpyvvvdikanafvhhmvrnivgslmevgahnqpeswiaellaakdrtlaaatakaegly
lvavdypdrydlpkppmgplflad

SCOPe Domain Coordinates for d1dj0b_:

Click to download the PDB-style file with coordinates for d1dj0b_.
(The format of our PDB-style files is described here.)

Timeline for d1dj0b_: