SCOPe 2.07: Domain d1dj0b_: 1dj0 B:

Lineage for d1dj0b_ (1dj0 B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
   consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold

4. Superfamily d.265.1: Pseudouridine synthase [55120] (5 families)
   the active site is the most conserved structural region of the superfamily and is located between the subdomains

5. Family d.265.1.1: Pseudouridine synthase I TruA [55121] (1 protein)

6. Protein Pseudouridine synthase I TruA [55122] (1 species)

7. Species Escherichia coli [TaxId:562] [55123] (4 PDB entries)

8. Domain d1dj0b_: 1dj0 B: [90338]
   complexed with cl

Details for d1dj0b_

PDB Entry: 1dj0, 1.5 Å

PDB Description: the crystal structure of e. coli pseudouridine synthase i at 1.5 angstrom resolution

PDB Compounds: (B:) pseudouridine synthase I

SCOPe Domain Sequences for d1dj0b_:

Sequence; same for both SEQRES and ATOM records:

>d1dj0b_ d.265.1.1 (B:) Pseudouridine synthase I TruA {Escherichia coli [TaxId: 562]}
ppvykialgieydgskyygwqrqnevrsvqeklekalsqvanepitvfcagrtdagvhgt
gqvvhfettalrkdaawtlgvnanlpgdiavrwvktvpddfharfsatarryryiiynhr
lrpavlskgvthfyepldaermhraaqcllgendftsfravqcqsrtpwrnvmhinvtrh
gpyvvvdikanafvhhmvrnivgslmevgahnqpeswiaellaakdrtlaaatakaegly
lvavdypdrydlpkppmgplflad

Timeline for d1dj0b_:

• d1dj0b_ first appeared in SCOP 1.67
  
• d1dj0b_ appears in SCOPe 2.06
  
• d1dj0b_ appears in the current release, SCOPe 2.08