Lineage for d1dj0a_ (1dj0 A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 881678Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 881679Superfamily d.265.1: Pseudouridine synthase [55120] (4 families) (S)
    the active site is the most conserved structural region of the superfamily and is located between the subdomains
  5. 881680Family d.265.1.1: Pseudouridine synthase I TruA [55121] (1 protein)
  6. 881681Protein Pseudouridine synthase I TruA [55122] (1 species)
  7. 881682Species Escherichia coli [TaxId:562] [55123] (4 PDB entries)
  8. 881683Domain d1dj0a_: 1dj0 A: [90337]

Details for d1dj0a_

PDB Entry: 1dj0 (more details), 1.5 Å

PDB Description: the crystal structure of e. coli pseudouridine synthase i at 1.5 angstrom resolution
PDB Compounds: (A:) pseudouridine synthase I

SCOP Domain Sequences for d1dj0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dj0a_ d.265.1.1 (A:) Pseudouridine synthase I TruA {Escherichia coli [TaxId: 562]}
ppvykialgieydgskyygwqrqnevrsvqeklekalsqvanepitvfcagrtdagvhgt
gqvvhfettalrkdaawtlgvnanlpgdiavrwvktvpddfharfsatarryryiiynhr
lrpavlskgvthfyepldaermhraaqcllgendftsfravqcqsrtpwrnvmhinvtrh
gpyvvvdikanafvhhmvrnivgslmevgahnqpeswiaellaakdrtlaaatakaegly
lvavdypdrydlpkppmgplflad

SCOP Domain Coordinates for d1dj0a_:

Click to download the PDB-style file with coordinates for d1dj0a_.
(The format of our PDB-style files is described here.)

Timeline for d1dj0a_: