SCOP 1.71: Domain d1dj0a_: 1dj0 A:

Lineage for d1dj0a_ (1dj0 A:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
   consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold

4. Superfamily d.265.1: Pseudouridine synthase [55120] (4 families)
   the active site is the most conserved structural region of the superfamily and is located between the subdomains

5. Family d.265.1.1: Pseudouridine synthase I TruA [55121] (1 protein)

6. Protein Pseudouridine synthase I TruA [55122] (1 species)

7. Species Escherichia coli [TaxId:562] [55123] (1 PDB entry)

8. Domain d1dj0a_: 1dj0 A: [90337]

Details for d1dj0a_

PDB Entry: 1dj0, 1.5 Å

PDB Description: the crystal structure of e. coli pseudouridine synthase i at 1.5 angstrom resolution

SCOP Domain Sequences for d1dj0a_:

Sequence; same for both SEQRES and ATOM records:

>d1dj0a_ d.265.1.1 (A:) Pseudouridine synthase I TruA {Escherichia coli}
ppvykialgieydgskyygwqrqnevrsvqeklekalsqvanepitvfcagrtdagvhgt
gqvvhfettalrkdaawtlgvnanlpgdiavrwvktvpddfharfsatarryryiiynhr
lrpavlskgvthfyepldaermhraaqcllgendftsfravqcqsrtpwrnvmhinvtrh
gpyvvvdikanafvhhmvrnivgslmevgahnqpeswiaellaakdrtlaaatakaegly
lvavdypdrydlpkppmgplflad

Timeline for d1dj0a_:

• d1dj0a_ first appeared in SCOP 1.67
  
• d1dj0a_ appears in SCOP 1.69
  
• d1dj0a_ appears in SCOP 1.73
  
• d1dj0a_ appears in the current release, SCOPe 2.08