Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (15 families) |
Family c.47.1.13: DsbA-like [100953] (2 proteins) contains an all-alpha subdomain insertion |
Protein Disulfide-bond formation facilitator (DsbA) [100954] (2 species) the insert subdomain is a 4-helical bundle |
Species Escherichia coli [TaxId:562] [100955] (12 PDB entries) |
Domain d1bq7d_: 1bq7 D: [90334] |
PDB Entry: 1bq7 (more details), 2.8 Å
SCOP Domain Sequences for d1bq7d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bq7d_ c.47.1.13 (D:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli} qyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyhv nfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikgee ydaawnsfvvkslvaqqekaaadvqlrgvaamfvngkyqlnpqgmdtsnmdvfvqqyadt vkylse
Timeline for d1bq7d_: