Lineage for d1bq7d_ (1bq7 D:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 486470Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 486471Superfamily c.47.1: Thioredoxin-like [52833] (15 families) (S)
  5. 487286Family c.47.1.13: DsbA-like [100953] (2 proteins)
    contains an all-alpha subdomain insertion
  6. 487287Protein Disulfide-bond formation facilitator (DsbA) [100954] (2 species)
    the insert subdomain is a 4-helical bundle
  7. 487288Species Escherichia coli [TaxId:562] [100955] (12 PDB entries)
  8. 487305Domain d1bq7d_: 1bq7 D: [90334]

Details for d1bq7d_

PDB Entry: 1bq7 (more details), 2.8 Å

PDB Description: dsba mutant p151a, role of the cis-proline in the active site of dsba

SCOP Domain Sequences for d1bq7d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bq7d_ c.47.1.13 (D:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli}
qyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyhv
nfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikgee
ydaawnsfvvkslvaqqekaaadvqlrgvaamfvngkyqlnpqgmdtsnmdvfvqqyadt
vkylse

SCOP Domain Coordinates for d1bq7d_:

Click to download the PDB-style file with coordinates for d1bq7d_.
(The format of our PDB-style files is described here.)

Timeline for d1bq7d_: