Lineage for d1a2j__ (1a2j -)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 395822Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 395823Superfamily c.47.1: Thioredoxin-like [52833] (14 families) (S)
  5. 396590Family c.47.1.13: DsbA-like [100953] (2 proteins)
    contains an all-alpha subdomain insertion
  6. 396591Protein Disulfide-bond formation facilitator (DsbA) [100954] (2 species)
    the insert subdomain is a 4-helical bundle
  7. 396592Species Escherichia coli [TaxId:562] [100955] (12 PDB entries)
  8. 396599Domain d1a2j__: 1a2j - [90321]

Details for d1a2j__

PDB Entry: 1a2j (more details), 2 Å

PDB Description: oxidized dsba crystal form ii

SCOP Domain Sequences for d1a2j__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a2j__ c.47.1.13 (-) Disulfide-bond formation facilitator (DsbA) {Escherichia coli}
aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
tvkylsek

SCOP Domain Coordinates for d1a2j__:

Click to download the PDB-style file with coordinates for d1a2j__.
(The format of our PDB-style files is described here.)

Timeline for d1a2j__: