SCOP 1.67: Domain d2f5bl2: 2f5b L:108-214

Lineage for d2f5bl2 (2f5b L:108-214)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (74 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d2f5bl2: 2f5b L:108-214 [88509]
   Other proteins in same PDB: d2f5bh1, d2f5bh2, d2f5bl1
   part of HIV-1 neutralizing Fab 2F5

Details for d2f5bl2

PDB Entry: 2f5b, 2 Å

PDB Description: crystal structure of fab' from the hiv-1 neutralizing antibody 2f5 in complex with its gp41 epitope

SCOP Domain Sequences for d2f5bl2:

Sequence; same for both SEQRES and ATOM records:

>d2f5bl2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyecevthqglsspvtksfnrgec

Timeline for d2f5bl2:

• d2f5bl2 first appeared in SCOP 1.65
  
• d2f5bl2 appears in SCOP 1.69
  
• d2f5bl2 appears in the current release, SCOPe 2.08