Lineage for d2f5bl1 (2f5b L:1-107)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287738Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287739Species Engineered (including hybrid species) [88533] (25 PDB entries)
  8. 287749Domain d2f5bl1: 2f5b L:1-107 [88508]
    Other proteins in same PDB: d2f5bh1, d2f5bh2, d2f5bl2
    part of humanized HIV-1 neutralizing Fab 2F5

Details for d2f5bl1

PDB Entry: 2f5b (more details), 2 Å

PDB Description: crystal structure of fab' from the hiv-1 neutralizing antibody 2f5 in complex with its gp41 epitope

SCOP Domain Sequences for d2f5bl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f5bl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
alqltqspsslsasvgdrititcrasqgvtsalawyrqkpgsppqlliydasslesgvps
rfsgsgsgteftltistlrpedfatyycqqlhfyphtfgggtrvdvr

SCOP Domain Coordinates for d2f5bl1:

Click to download the PDB-style file with coordinates for d2f5bl1.
(The format of our PDB-style files is described here.)

Timeline for d2f5bl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f5bl2