Lineage for d2f5bh2 (2f5b H:133-235)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289100Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 289104Species Human (Homo sapiens) [TaxId:9606] [88575] (63 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 289122Domain d2f5bh2: 2f5b H:133-235 [88507]
    Other proteins in same PDB: d2f5bh1, d2f5bl1, d2f5bl2
    part of HIV-1 neutralizing Fab 2F5

Details for d2f5bh2

PDB Entry: 2f5b (more details), 2 Å

PDB Description: crystal structure of fab' from the hiv-1 neutralizing antibody 2f5 in complex with its gp41 epitope

SCOP Domain Sequences for d2f5bh2:

Sequence, based on SEQRES records: (download)

>d2f5bh2 b.1.1.2 (H:133-235) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
tstkgpsvfplapsskstaggaaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtytcnvnhkpsntkvdkrvepksc

Sequence, based on observed residues (ATOM records): (download)

>d2f5bh2 b.1.1.2 (H:133-235) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
tstkgpsvfplapssaggaaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
slssvvtvpssslgtqtytcnvnhkpsntkvdkrvepksc

SCOP Domain Coordinates for d2f5bh2:

Click to download the PDB-style file with coordinates for d2f5bh2.
(The format of our PDB-style files is described here.)

Timeline for d2f5bh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f5bh1