SCOP 1.67: Domain d2f5bh1: 2f5b H:1-132

Lineage for d2f5bh1 (2f5b H:1-132)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88562] (28 PDB entries)

8. Domain d2f5bh1: 2f5b H:1-132 [88506]
   Other proteins in same PDB: d2f5bh2, d2f5bl1, d2f5bl2
   part of humanized HIV-1 neutralizing Fab 2F5

Details for d2f5bh1

PDB Entry: 2f5b, 2 Å

PDB Description: crystal structure of fab' from the hiv-1 neutralizing antibody 2f5 in complex with its gp41 epitope

SCOP Domain Sequences for d2f5bh1:

Sequence; same for both SEQRES and ATOM records:

>d2f5bh1 b.1.1.1 (H:1-132) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)}
ritlkesgpplvkptqtltltcsfsgfslsdfgvgvgwirqppgkalewlaiiysdddkr
yspslntrltitkdtsknqvvlvmtrvspvdtatyfcahrrgpttlfgvpiargpvnamd
vwgqgitvtiss

Timeline for d2f5bh1:

• d2f5bh1 first appeared in SCOP 1.65
  
• d2f5bh1 appears in SCOP 1.69
  
• d2f5bh1 appears in the current release, SCOPe 2.08