SCOPe 2.03: Domain d2f5al1: 2f5a L:1-107

Lineage for d2f5al1 (2f5a L:1-107)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88533] (61 PDB entries)
   SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # Humanized antibody ! SQ NA # humanized antibody ! SQ NA # engineered antibody

8. Domain d2f5al1: 2f5a L:1-107 [88504]
   Other proteins in same PDB: d2f5ah1, d2f5ah2, d2f5al2
   part of humanized HIV-1 neutralizing Fab 2F5

Details for d2f5al1

PDB Entry: 2f5a, 2.05 Å

PDB Description: crystal structure of fab' from the hiv-1 neutralizing antibody 2f5

PDB Compounds: (L:) protein (antibody 2f5 (light chain))

SCOPe Domain Sequences for d2f5al1:

Sequence; same for both SEQRES and ATOM records:

>d2f5al1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
alqltqspsslsasvgdrititcrasqgvtsalawyrqkpgsppqlliydasslesgvps
rfsgsgsgteftltistlrpedfatyycqqlhfyphtfgggtrvdvr

Timeline for d2f5al1:

• d2f5al1 first appeared in SCOP 1.65
  
• d2f5al1 appears in SCOPe 2.02
  
• d2f5al1 appears in SCOPe 2.04
  
• d2f5al1 appears in the current release, SCOPe 2.08