Lineage for d2f5ah2 (2f5a H:133-232)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453267Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 453271Species Human (Homo sapiens) [TaxId:9606] [88575] (82 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 453301Domain d2f5ah2: 2f5a H:133-232 [88503]
    Other proteins in same PDB: d2f5ah1, d2f5al1, d2f5al2
    part of HIV-1 neutralizing Fab 2F5

Details for d2f5ah2

PDB Entry: 2f5a (more details), 2.05 Å

PDB Description: crystal structure of fab' from the hiv-1 neutralizing antibody 2f5
PDB Compounds: (H:)

SCOP Domain Sequences for d2f5ah2:

Sequence, based on SEQRES records: (download)

>d2f5ah2 b.1.1.2 (H:133-232) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
tstkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtytcnvnhkpsntkvdkrvep

Sequence, based on observed residues (ATOM records): (download)

>d2f5ah2 b.1.1.2 (H:133-232) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
tstkgpsvfplapssggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
lssvvtvpssslgtqtytcnvnhkpsntkvdkrvep

SCOP Domain Coordinates for d2f5ah2:

Click to download the PDB-style file with coordinates for d2f5ah2.
(The format of our PDB-style files is described here.)

Timeline for d2f5ah2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2f5ah1