Lineage for d2e2ab_ (2e2a B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696503Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2696555Superfamily a.7.2: Enzyme IIa from lactose specific PTS, IIa-lac [46973] (2 families) (S)
  5. 2696556Family a.7.2.1: Enzyme IIa from lactose specific PTS, IIa-lac [46974] (1 protein)
    form trimers with 9 helices in a bundle
    automatically mapped to Pfam PF02255
    this is a repeat family; one repeat unit is 2e2a A: found in domain
  6. 2696557Protein Enzyme IIa from lactose specific PTS, IIa-lac [46975] (1 species)
  7. 2696558Species Lactococcus lactis [TaxId:1358] [46976] (2 PDB entries)
  8. 2696563Domain d2e2ab_: 2e2a B: [88500]

Details for d2e2ab_

PDB Entry: 2e2a (more details), 2.1 Å

PDB Description: asp81leu enzyme iia from the lactose specific pts from lactococcus lactis
PDB Compounds: (B:) protein (enzyme iia)

SCOPe Domain Sequences for d2e2ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e2ab_ a.7.2.1 (B:) Enzyme IIa from lactose specific PTS, IIa-lac {Lactococcus lactis [TaxId: 1358]}
mnreemtllgfeivayagdarskllealkaaengdfakadslvveagsciaeahssqtgm
lareasgeelpysvtmmhgqlhlmttillkdvihhlielykrga

SCOPe Domain Coordinates for d2e2ab_:

Click to download the PDB-style file with coordinates for d2e2ab_.
(The format of our PDB-style files is described here.)

Timeline for d2e2ab_: