Lineage for d1ui9a_ (1ui9 A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 506461Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 506462Superfamily d.79.1: YjgF-like [55298] (2 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 506510Family d.79.1.2: Chorismate mutase [55304] (1 protein)
  6. 506511Protein Chorismate mutase [55305] (2 species)
  7. 506554Species Thermus thermophilus [TaxId:274] [89981] (3 PDB entries)
  8. 506556Domain d1ui9a_: 1ui9 A: [88496]

Details for d1ui9a_

PDB Entry: 1ui9 (more details), 1.65 Å

PDB Description: Crystal analysis of chorismate mutase from thermus thermophilus

SCOP Domain Sequences for d1ui9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ui9a_ d.79.1.2 (A:) Chorismate mutase {Thermus thermophilus}
mvrgirgaitveedtpeaihqatrelllkmleangiqsyeelaaviftvtedltfafpae
aarqigmhrvpllsarevpvpgslprvirvlalwntdtpqdrvrhvylreavrlrp

SCOP Domain Coordinates for d1ui9a_:

Click to download the PDB-style file with coordinates for d1ui9a_.
(The format of our PDB-style files is described here.)

Timeline for d1ui9a_: