SCOP 1.69: Domain d1ufvb_: 1ufv B:

Lineage for d1ufvb_ (1ufv B:)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families)

5. Family c.26.1.4: Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63976] (1 protein)
   contains C-terminal subdomain similar to one structural repeat of the Creatinase/aminopeptidase family

6. Protein Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63977] (3 species)

7. Species Thermus thermophilus [TaxId:274] [89616] (2 PDB entries)

8. Domain d1ufvb_: 1ufv B: [88488]
   structural genomics

Details for d1ufvb_

PDB Entry: 1ufv, 2.05 Å

PDB Description: Crystal Structure Of Pantothenate Synthetase From Thermus Thermophilus HB8

SCOP Domain Sequences for d1ufvb_:

Sequence; same for both SEQRES and ATOM records:

>d1ufvb_ c.26.1.4 (B:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Thermus thermophilus}
mrtvstvaelraalpregvgfvptmgylhrghlalverarrenpfvvasvfvnplqfgpg
edyhryprdlerdrallqeagvdllfapgveemypegfatrvqvegpltalwegavrpgh
fqgvatvvarlfllvqpqrayfgekdyqqllvvrrmvrdlgfpvevvgvptvreedglal
ssrnvylspetrkkapvlyrallamrevagqggsvaealrageealravpefrkdylaiv
hpetllplsdwvagargivagrfpearlidnlevyp

Timeline for d1ufvb_:

• d1ufvb_ first appeared in SCOP 1.65
  
• d1ufvb_ appears in SCOP 1.67
  
• d1ufvb_ appears in SCOP 1.71
  
• d1ufvb_ appears in the current release, SCOPe 2.08