Lineage for d1ufvb_ (1ufv B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860642Family c.26.1.4: Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63976] (2 proteins)
    contains C-terminal subdomain similar to one structural repeat of the Creatinase/aminopeptidase family
    automatically mapped to Pfam PF02569
  6. 2860643Protein Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63977] (5 species)
  7. 2860748Species Thermus thermophilus [TaxId:274] [89616] (2 PDB entries)
  8. 2860752Domain d1ufvb_: 1ufv B: [88488]
    structural genomics
    complexed with cl, gol

Details for d1ufvb_

PDB Entry: 1ufv (more details), 2.05 Å

PDB Description: Crystal Structure Of Pantothenate Synthetase From Thermus Thermophilus HB8
PDB Compounds: (B:) Pantoate-beta-alanine ligase

SCOPe Domain Sequences for d1ufvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ufvb_ c.26.1.4 (B:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Thermus thermophilus [TaxId: 274]}
mrtvstvaelraalpregvgfvptmgylhrghlalverarrenpfvvasvfvnplqfgpg
edyhryprdlerdrallqeagvdllfapgveemypegfatrvqvegpltalwegavrpgh
fqgvatvvarlfllvqpqrayfgekdyqqllvvrrmvrdlgfpvevvgvptvreedglal
ssrnvylspetrkkapvlyrallamrevagqggsvaealrageealravpefrkdylaiv
hpetllplsdwvagargivagrfpearlidnlevyp

SCOPe Domain Coordinates for d1ufvb_:

Click to download the PDB-style file with coordinates for d1ufvb_.
(The format of our PDB-style files is described here.)

Timeline for d1ufvb_: