![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
![]() | Protein Putative acetyltransferase YycN [90011] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [90012] (2 PDB entries) |
![]() | Domain d1ufhb_: 1ufh B: [88486] structural genomics |
PDB Entry: 1ufh (more details), 2.2 Å
SCOPe Domain Sequences for d1ufhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ufhb_ d.108.1.1 (B:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} imltpmqteefrsyltyttkhyaeekvkagtwlpedaqllskqvftdllprgletphhhl wslklnekdivgwlwihaepehpqqeafiydfglyepyrgkgyakqalaaldqaarsmgi rklslhvfahnqtarklyeqtgfqetdvvmskkl
Timeline for d1ufhb_: