SCOPe 2.08: Domain d1ufha_: 1ufh A:

Lineage for d1ufha_ (1ufh A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)

6. Protein Putative acetyltransferase YycN [90011] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [90012] (2 PDB entries)

8. Domain d1ufha_: 1ufh A: [88485]
   structural genomics

Details for d1ufha_

PDB Entry: 1ufh, 2.2 Å

PDB Description: structure of putative acetyltransferase, yycn protein of bacillus subtilis

PDB Compounds: (A:) YycN protein

SCOPe Domain Sequences for d1ufha_:

Sequence; same for both SEQRES and ATOM records:

>d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]}
timltpmqteefrsyltyttkhyaeekvkagtwlpedaqllskqvftdllprgletphhh
lwslklnekdivgwlwihaepehpqqeafiydfglyepyrgkgyakqalaaldqaarsmg
irklslhvfahnqtarklyeqtgfqetdvvmskkl

Timeline for d1ufha_:

• d1ufha_ first appeared in SCOP 1.65
  
• d1ufha_ appears in SCOPe 2.07