Class b: All beta proteins [48724] (177 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein p47pox (neutrophil cytosolic factor 1) [89295] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [89296] (4 PDB entries) |
Domain d1ueca2: 1uec A:215-336 [88482] N-terminal domain forms a segment-swapped dimer; C-terminal domain includes the autoinhibition tail region, residues 284-336 |
PDB Entry: 1uec (more details), 1.82 Å
SCOPe Domain Sequences for d1ueca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ueca2 b.34.2.1 (A:215-336) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} spdetedpepnyagepyvaikaytavegdevsllegeavevihklldgwwvirkddvtgy fpsmylqksgqdvsqaqrqikrgapprrssirnahsihqrsrkrlsqdayrrnsvrflqq rr
Timeline for d1ueca2: