Lineage for d1ud8a2 (1ud8 A:1-390)
- Root: SCOP 1.65
Class c: Alpha and beta proteins (a/b) [51349] (121 folds) 
Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (9 families) 
Family c.1.8.1: Amylase, catalytic domain [51446] (22 proteins)
members of the family may contain various insert subdomains
in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
Protein Bacterial alpha-amylase [51447] (7 species) 
Species Bacillus sp., ksm-k38 [TaxId:1409] [89463] (6 PDB entries) 
Domain d1ud8a2: 1ud8 A:1-390 [88480]
Other proteins in same PDB: d1ud8a1
complexed with na
Details for d1ud8a2
PDB Entry: 1ud8 (more details), 2.88 Å
PDB Description: Crystal structure of AmyK38 with lithium ion
SCOP Domain Sequences for d1ud8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ud8a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38}
dglngtmmqyyewhlendgqhwnrlhddaaalsdagitaiwippaykgnsqadvgygayd
lydlgefnqkgtvrtkygtkaqleraigslksndinvygdvvmnhkmgadfteavqavqv
nptnrwqdisgaytidawtgfdfsgrnnaysdfkwrwfhfngvdwdqryqenhifrfant
nwnwrvdeengnydyllgsnidfshpevqdelkdwgswftdeldldgyrldaikhipfwy
tsdwvrhqrneadqdlfvvgeywkddvgalefyldemnwemslfdvplnynfyrasqqgg
sydmrnilrgslveahpmhavtfvdnhdtqpgesleswvadwfkplayatiltreggypn
vfygdyygipndnisakkdmidelldarqn
SCOP Domain Coordinates for d1ud8a2:
Click to download the PDB-style file with coordinates for d1ud8a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ud8a2:
- d1ud8a2 is new in SCOP 1.65
- d1ud8a2 appears in SCOP 1.67
- d1ud8a2 appears in the current release, SCOPe 2.08
View in 3D
