SCOPe 2.07: Domain d1ud8a1: 1ud8 A:391-480

Lineage for d1ud8a1 (1ud8 A:391-480)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Bacterial alpha-Amylase [51013] (9 species)

7. Species Bacillus sp., ksm-k38 [TaxId:1409] [89382] (6 PDB entries)

8. Domain d1ud8a1: 1ud8 A:391-480 [88479]
   Other proteins in same PDB: d1ud8a2
   complexed with na

Details for d1ud8a1

PDB Entry: 1ud8, 2.88 Å

PDB Description: Crystal structure of AmyK38 with lithium ion

PDB Compounds: (A:) amylase

SCOPe Domain Sequences for d1ud8a1:

Sequence; same for both SEQRES and ATOM records:

>d1ud8a1 b.71.1.1 (A:391-480) Bacterial alpha-Amylase {Bacillus sp., ksm-k38 [TaxId: 1409]}
yaygtqhdyfdhwdvvgwtregsssrpnsglatimsngpggskwmyvgrqnagqtwtdlt
gnngasvtingdgwgefftnggsvsvyvnq

Timeline for d1ud8a1:

• d1ud8a1 first appeared in SCOP 1.65
  
• d1ud8a1 appears in SCOPe 2.06
  
• d1ud8a1 appears in the current release, SCOPe 2.08