![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (3 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins) this domain follows the catalytic beta/alpha barrel domain |
![]() | Protein Bacterial alpha-Amylase [51013] (6 species) |
![]() | Species Bacillus sp., ksm-k38 [TaxId:1409] [89382] (6 PDB entries) |
![]() | Domain d1ud8a1: 1ud8 A:391-480 [88479] Other proteins in same PDB: d1ud8a2 complexed with na |
PDB Entry: 1ud8 (more details), 2.88 Å
SCOP Domain Sequences for d1ud8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ud8a1 b.71.1.1 (A:391-480) Bacterial alpha-Amylase {Bacillus sp., ksm-k38} yaygtqhdyfdhwdvvgwtregsssrpnsglatimsngpggskwmyvgrqnagqtwtdlt gnngasvtingdgwgefftnggsvsvyvnq
Timeline for d1ud8a1: