Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Ig alpha Fc receptor, FCARI (CD89) [89188] (1 species) possibly an intermediate structure between the I set and FnIII domains |
Species Human (Homo sapiens) [TaxId:9606] [89189] (3 PDB entries) |
Domain d1ucta2: 1uct A:101-196 [88468] |
PDB Entry: 1uct (more details), 2.1 Å
SCOPe Domain Sequences for d1ucta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ucta2 b.1.1.4 (A:101-196) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} glygkpflsadrglvlmpgenisltcssahipfdrfslakegelslpqhqsgehpanfsl gpvdlnvsgiyrcygwynrspylwsfpsnalelvvt
Timeline for d1ucta2: