SCOPe 2.07: Domain d1ucta2: 1uct A:101-196

Lineage for d1ucta2 (1uct A:101-196)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Ig alpha Fc receptor, FCARI (CD89) [89188] (1 species)
   possibly an intermediate structure between the I set and FnIII domains

7. Species Human (Homo sapiens) [TaxId:9606] [89189] (3 PDB entries)

8. Domain d1ucta2: 1uct A:101-196 [88468]

Details for d1ucta2

PDB Entry: 1uct, 2.1 Å

PDB Description: Crystal structure of the extracellular fragment of Fc alpha Receptor I (CD89)

PDB Compounds: (A:) Immunoglobulin alpha Fc receptor

SCOPe Domain Sequences for d1ucta2:

Sequence; same for both SEQRES and ATOM records:

>d1ucta2 b.1.1.4 (A:101-196) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]}
glygkpflsadrglvlmpgenisltcssahipfdrfslakegelslpqhqsgehpanfsl
gpvdlnvsgiyrcygwynrspylwsfpsnalelvvt

Timeline for d1ucta2:

• d1ucta2 first appeared in SCOP 1.65
  
• d1ucta2 appears in SCOPe 2.06
  
• d1ucta2 appears in the current release, SCOPe 2.08