Lineage for d1ucta1 (1uct A:2-100)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 290223Family b.1.1.4: I set domains [49159] (29 proteins)
  6. 290320Protein Ig alpha Fc receptor, FCARI (CD89) [89188] (1 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 290321Species Human (Homo sapiens) [TaxId:9606] [89189] (3 PDB entries)
  8. 290322Domain d1ucta1: 1uct A:2-100 [88467]

Details for d1ucta1

PDB Entry: 1uct (more details), 2.1 Å

PDB Description: Crystal structure of the extracellular fragment of Fc alpha Receptor I (CD89)

SCOP Domain Sequences for d1ucta1:

Sequence, based on SEQRES records: (download)

>d1ucta1 b.1.1.4 (A:2-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens)}
qegdfpmpfisaksspvipldgsvkiqcqaireayltqlmiiknstyreigrrlkfwnet
dpefvidhmdankagryqcqyrighyrfrysdtlelvvt

Sequence, based on observed residues (ATOM records): (download)

>d1ucta1 b.1.1.4 (A:2-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens)}
qegdfpmpfisaksspvipldgsvkiqcqaireayltqlmiiknstyreigrrlktdpef
vidhmdankagryqcqyrighyrfrysdtlelvvt

SCOP Domain Coordinates for d1ucta1:

Click to download the PDB-style file with coordinates for d1ucta1.
(The format of our PDB-style files is described here.)

Timeline for d1ucta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ucta2