SCOPe 2.06: Domain d1ucga_: 1ucg A:

Lineage for d1ucga_ (1ucg A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.124: Ribonuclease Rh-like [55894] (1 superfamily)
   alpha+beta fold

4. Superfamily d.124.1: Ribonuclease Rh-like [55895] (2 families)

5. Family d.124.1.1: Ribonuclease Rh-like [55896] (9 proteins)

6. Protein Ribonuclease MC1 [55899] (1 species)

7. Species Bitter gourd (Momordica charantia) [TaxId:3673] [55900] (8 PDB entries)
   Uniprot P23540

8. Domain d1ucga_: 1ucg A: [88464]
   complexed with mn; mutant

Details for d1ucga_

PDB Entry: 1ucg, 1.65 Å

PDB Description: crystal structure of ribonuclease mc1 n71t mutant

PDB Compounds: (A:) Ribonuclease MC

SCOPe Domain Sequences for d1ucga_:

Sequence; same for both SEQRES and ATOM records:

>d1ucga_ d.124.1.1 (A:) Ribonuclease MC1 {Bitter gourd (Momordica charantia) [TaxId: 3673]}
mdsfwfvqqwppavcsfqksgscpgsglrtftihglwpqqsgtsltncpgspfditkish
lqsqlntlwptvlrannqqfwshewtkhgtcsestfnqaayfklavdmrnnydiigalrp
haagpngrtksrqaikgflkakfgkfpglrcrtdpqtkvsylvqvvacfaqdgstlidct
rdtcganfif

Timeline for d1ucga_:

• d1ucga_ first appeared in SCOP 1.65
  
• d1ucga_ appears in SCOPe 2.05
  
• d1ucga_ appears in SCOPe 2.07
  
• d1ucga_ appears in the current release, SCOPe 2.08