SCOP 1.65: Domain d1ucga_: 1ucg A:

Lineage for d1ucga_ (1ucg A:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.124: Ribonuclease Rh-like [55894] (1 superfamily)
   alpha+beta fold

4. Superfamily d.124.1: Ribonuclease Rh-like [55895] (1 family)

5. Family d.124.1.1: Ribonuclease Rh-like [55896] (6 proteins)

6. Protein Ribonuclease MC1 [55899] (1 species)

7. Species Bitter gourd (Momordica charantia) [TaxId:3673] [55900] (6 PDB entries)

8. Domain d1ucga_: 1ucg A: [88464]

Details for d1ucga_

PDB Entry: 1ucg, 1.65 Å

PDB Description: crystal structure of ribonuclease mc1 n71t mutant

SCOP Domain Sequences for d1ucga_:

Sequence; same for both SEQRES and ATOM records:

>d1ucga_ d.124.1.1 (A:) Ribonuclease MC1 {Bitter gourd (Momordica charantia)}
mdsfwfvqqwppavcsfqksgscpgsglrtftihglwpqqsgtsltncpgspfditkish
lqsqlntlwptvlrannqqfwshewtkhgtcsestfnqaayfklavdmrnnydiigalrp
haagpngrtksrqaikgflkakfgkfpglrcrtdpqtkvsylvqvvacfaqdgstlidct
rdtcganfif

Timeline for d1ucga_:

• d1ucga_ is new in SCOP 1.65
  
• d1ucga_ appears in SCOP 1.67
  
• d1ucga_ appears in the current release, SCOPe 2.08