Lineage for d1ucca_ (1ucc A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2580771Fold d.124: Ribonuclease Rh-like [55894] (1 superfamily)
    alpha+beta fold
  4. 2580772Superfamily d.124.1: Ribonuclease Rh-like [55895] (2 families) (S)
  5. 2580773Family d.124.1.1: Ribonuclease Rh-like [55896] (9 proteins)
  6. 2580778Protein Ribonuclease MC1 [55899] (1 species)
  7. 2580779Species Bitter gourd (Momordica charantia) [TaxId:3673] [55900] (8 PDB entries)
    Uniprot P23540
  8. 2580784Domain d1ucca_: 1ucc A: [88463]
    complexed with u3p

Details for d1ucca_

PDB Entry: 1ucc (more details), 1.77 Å

PDB Description: Crystal structure of the Ribonuclease MC1 from bitter gourd seeds complexed with 3'-UMP.
PDB Compounds: (A:) Ribonuclease MC

SCOPe Domain Sequences for d1ucca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ucca_ d.124.1.1 (A:) Ribonuclease MC1 {Bitter gourd (Momordica charantia) [TaxId: 3673]}
fdsfwfvqqwppavcsfqksgscpgsglrtftihglwpqqsgtsltncpgspfditkish
lqsqlntlwpnvlrannqqfwshewtkhgtcsestfnqaayfklavdmrnnydiigalrp
haagpngrtksrqaikgflkakfgkfpglrcrtdpqtkvsylvqvvacfaqdgstlidct
rdtcganfif

SCOPe Domain Coordinates for d1ucca_:

Click to download the PDB-style file with coordinates for d1ucca_.
(The format of our PDB-style files is described here.)

Timeline for d1ucca_: