Lineage for d1ucaa_ (1uca A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.124: Ribonuclease Rh-like [55894] (1 superfamily)
    alpha+beta fold
  4. Superfamily d.124.1: Ribonuclease Rh-like [55895] (2 families) (S)
  5. Family d.124.1.1: Ribonuclease Rh-like [55896] (9 proteins)
  6. Protein Ribonuclease MC1 [55899] (1 species)
  7. Species Bitter gourd (Momordica charantia) [TaxId:3673] [55900] (8 PDB entries)
    Uniprot P23540
  8. Domain d1ucaa_: 1uca A: [88462]
    complexed with u2p

Details for d1ucaa_

PDB Entry: 1uca (more details), 1.48 Å

PDB Description: Crystal structure of the Ribonuclease MC1 from bitter gourd seeds complexed with 2'-UMP
PDB Compounds: (A:) Ribonuclease MC

SCOPe Domain Sequences for d1ucaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ucaa_ d.124.1.1 (A:) Ribonuclease MC1 {Bitter gourd (Momordica charantia) [TaxId: 3673]}
fdsfwfvqqwppavcsfqksgscpgsglrtftihglwpqqsgtsltncpgspfditkish
lqsqlntlwpnvlrannqqfwshewtkhgtcsestfnqaayfklavdmrnnydiigalrp
haagpngrtksrqaikgflkakfgkfpglrcrtdpqtkvsylvqvvacfaqdgstlidct
rdtcganfif

SCOPe Domain Coordinates for d1ucaa_ are not available.

Timeline for d1ucaa_: