Lineage for d1uc5g_ (1uc5 G:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 279213Fold a.23: Open three-helical up-and-down bundle [47143] (5 superfamilies)
    core: 3 helices; bundle, open
  4. 279221Superfamily a.23.2: Diol dehydratase, gamma subunit [47148] (1 family) (S)
    contains irregular N-terminal subdomain
  5. 279222Family a.23.2.1: Diol dehydratase, gamma subunit [47149] (1 protein)
  6. 279223Protein Diol dehydratase, gamma subunit [47150] (2 species)
  7. 279224Species Klebsiella oxytoca [TaxId:571] [47151] (7 PDB entries)
  8. 279237Domain d1uc5g_: 1uc5 G: [88459]
    Other proteins in same PDB: d1uc5a_, d1uc5b_, d1uc5e_, d1uc5l_

Details for d1uc5g_

PDB Entry: 1uc5 (more details), 2.3 Å

PDB Description: Structure of diol dehydratase complexed with (R)-1,2-propanediol

SCOP Domain Sequences for d1uc5g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uc5g_ a.23.2.1 (G:) Diol dehydratase, gamma subunit {Klebsiella oxytoca}
sarvsdyplankhpewvktatnktlddftlenvlsnkvtaqdmritpetlrlqasiakda
grdrlamnferaaeltavpddrileiynalrpyrstkeellaiaddlesryqakicaafv
reaatlyverkklkgdd

SCOP Domain Coordinates for d1uc5g_:

Click to download the PDB-style file with coordinates for d1uc5g_.
(The format of our PDB-style files is described here.)

Timeline for d1uc5g_: