SCOP 1.65: Domain d1uc4g_: 1uc4 G:

Lineage for d1uc4g_ (1uc4 G:)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.23: Open three-helical up-and-down bundle [47143] (5 superfamilies)
   core: 3 helices; bundle, open

4. Superfamily a.23.2: Diol dehydratase, gamma subunit [47148] (1 family)
   contains irregular N-terminal subdomain

5. Family a.23.2.1: Diol dehydratase, gamma subunit [47149] (1 protein)

6. Protein Diol dehydratase, gamma subunit [47150] (2 species)

7. Species Klebsiella oxytoca [TaxId:571] [47151] (7 PDB entries)

8. Domain d1uc4g_: 1uc4 G: [88453]
   Other proteins in same PDB: d1uc4a_, d1uc4b_, d1uc4e_, d1uc4l_

Details for d1uc4g_

PDB Entry: 1uc4, 1.8 Å

PDB Description: structure of diol dehydratase complexed with (s)-1,2-propanediol

SCOP Domain Sequences for d1uc4g_:

Sequence; same for both SEQRES and ATOM records:

>d1uc4g_ a.23.2.1 (G:) Diol dehydratase, gamma subunit {Klebsiella oxytoca}
sarvsdyplankhpewvktatnktlddftlenvlsnkvtaqdmritpetlrlqasiakda
grdrlamnferaaeltavpddrileiynalrpyrstkeellaiaddlesryqakicaafv
reaatlyverkklkgdd

Timeline for d1uc4g_:

• d1uc4g_ is new in SCOP 1.65
  
• d1uc4g_ appears in SCOP 1.67
  
• d1uc4g_ appears in the current release, SCOPe 2.08