SCOPe 2.05: Domain d1uc4e_: 1uc4 E:

Lineage for d1uc4e_ (1uc4 E:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.3: B12-dependent dehydatase associated subunit [52968] (2 families)

5. Family c.51.3.1: Diol dehydratase, beta subunit [52969] (1 protein)
   contains additional structures in the C-terminal extension

6. Protein Diol dehydratase, beta subunit [52970] (2 species)

7. Species Klebsiella oxytoca [TaxId:571] [52971] (8 PDB entries)

8. Domain d1uc4e_: 1uc4 E: [88452]
   Other proteins in same PDB: d1uc4a_, d1uc4g_, d1uc4l_, d1uc4m_
   complexed with cnc, k, nh4, pgo

Details for d1uc4e_

PDB Entry: 1uc4, 1.8 Å

PDB Description: structure of diol dehydratase complexed with (s)-1,2-propanediol

PDB Compounds: (E:) diol dehydrase beta subunit

SCOPe Domain Sequences for d1uc4e_:

Sequence; same for both SEQRES and ATOM records:

>d1uc4e_ c.51.3.1 (E:) Diol dehydratase, beta subunit {Klebsiella oxytoca [TaxId: 571]}
fltevgearqgtqqdeviiavgpafglaqtvnivgiphksilreviagieeegikarvir
cfkssdvafvavegnrlsgsgisigiqskgttvihqqglpplsnlelfpqaplltletyr
qigknaaryakrespqpvptlndqmarpkyqaksailhiketkyvvtgknpqelrv

Timeline for d1uc4e_:

• d1uc4e_ first appeared in SCOP 1.65
  
• d1uc4e_ appears in SCOPe 2.04
  
• d1uc4e_ appears in SCOPe 2.06
  
• d1uc4e_ appears in the current release, SCOPe 2.08