Lineage for d1uc3c_ (1uc3 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2687786Protein Lamprey globin [46518] (2 species)
  7. 2687787Species Lamprey (Lampetra fluviatilis) [TaxId:7748] [88966] (1 PDB entry)
  8. 2687790Domain d1uc3c_: 1uc3 C: [88440]
    complexed with hem

Details for d1uc3c_

PDB Entry: 1uc3 (more details), 2.3 Å

PDB Description: crystal structure of hemoglobin i from river lamprey
PDB Compounds: (C:) globin

SCOPe Domain Sequences for d1uc3c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uc3c_ a.1.1.2 (C:) Lamprey globin {Lamprey (Lampetra fluviatilis) [TaxId: 7748]}
pivdsgsvaplsaaektkirsawapvysnyetsgvdilvkfftstpaaqeffpkfkgmts
adqlkksadvrwhaeriinavndavasmddtekmsmklrdlsgkhaksfqvdpqyfkvla
aviadtvaagdagfeklmsmicillrsay

SCOPe Domain Coordinates for d1uc3c_:

Click to download the PDB-style file with coordinates for d1uc3c_.
(The format of our PDB-style files is described here.)

Timeline for d1uc3c_: