Class a: All alpha proteins [46456] (285 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Lamprey globin [46518] (2 species) |
Species Lamprey (Lampetra fluviatilis) [TaxId:7748] [88966] (1 PDB entry) |
Domain d1uc3a_: 1uc3 A: [88438] complexed with hem |
PDB Entry: 1uc3 (more details), 2.3 Å
SCOPe Domain Sequences for d1uc3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uc3a_ a.1.1.2 (A:) Lamprey globin {Lamprey (Lampetra fluviatilis) [TaxId: 7748]} pivdsgsvaplsaaektkirsawapvysnyetsgvdilvkfftstpaaqeffpkfkgmts adqlkksadvrwhaeriinavndavasmddtekmsmklrdlsgkhaksfqvdpqyfkvla aviadtvaagdagfeklmsmicillrsay
Timeline for d1uc3a_: