Lineage for d1ubrl_ (1ubr L:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2573281Fold e.18: HydB/Nqo4-like [56761] (1 superfamily)
    3 domains: (1) all-alpha; (2&3) alpha+beta
  4. 2573282Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) (S)
  5. 2573283Family e.18.1.1: Nickel-iron hydrogenase, large subunit [56763] (2 proteins)
  6. 2573284Protein Nickel-iron hydrogenase, large subunit [56764] (5 species)
  7. 2573302Species Desulfovibrio vulgaris [TaxId:881] [56766] (11 PDB entries)
  8. 2573308Domain d1ubrl_: 1ubr L: [88430]
    Other proteins in same PDB: d1ubrs_
    complexed with cmo, f3s, fne, mg, sf4

Details for d1ubrl_

PDB Entry: 1ubr (more details), 1.34 Å

PDB Description: three-dimensional structure of the carbon monoxide complex of [nife]hydrogenase from desulufovibrio vulgaris miyazaki f
PDB Compounds: (L:) Periplasmic [NiFe] hydrogenase Large subunit

SCOPe Domain Sequences for d1ubrl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ubrl_ e.18.1.1 (L:) Nickel-iron hydrogenase, large subunit {Desulfovibrio vulgaris [TaxId: 881]}
ssysgpivvdpvtrieghlrievevengkvknayssstlfrgleiilkgrdprdaqhftq
rtcgvctythalastrcvdnavgvhipknatyirnlvlgaqylhdhivhfyhlhaldfvd
vtaalkadpakaakvassisprkttaadlkavqdklktfvetgqlgpftnayflgghpay
yldpetnliatahylealrlqvkaaramavfgaknphtqftvvggvtcydaltpqriaef
ealwketkafvdevyipdllvvaaaykdwtqyggtdnfitfgefpkdeydlnsrffkpgv
vfkrdfknikpfdkmqieehvrhswyegaearhpwkgqtqpkytdlhgddryswmkapry
mgepmetgplaqvliaysqghpkvkavtdavlaklgvgpealfstlgrtaargietavia
eyvgvmlqeykdniakgdnvicapwempkqaegvgfvnaprgglshwiriedgkignfql
vvpstwtlgprcdknklspveasligtpvadakrpveilrtvhsfdpciacgvh

SCOPe Domain Coordinates for d1ubrl_:

Click to download the PDB-style file with coordinates for d1ubrl_.
(The format of our PDB-style files is described here.)

Timeline for d1ubrl_: