![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (40 folds) |
![]() | Fold e.19: Nickel-iron hydrogenase, small subunit [56769] (1 superfamily) 2 domains: (1) alpa/beta; (2) Fe-S cluster-bound |
![]() | Superfamily e.19.1: Nickel-iron hydrogenase, small subunit [56770] (1 family) ![]() |
![]() | Family e.19.1.1: Nickel-iron hydrogenase, small subunit [56771] (1 protein) |
![]() | Protein Nickel-iron hydrogenase, small subunit [56772] (5 species) |
![]() | Species Desulfovibrio vulgaris [TaxId:881] [56774] (11 PDB entries) |
![]() | Domain d1ubos_: 1ubo S: [88429] Other proteins in same PDB: d1ubol_ complexed with cmo, fne, fs3, fs4, mg |
PDB Entry: 1ubo (more details), 1.35 Å
SCOP Domain Sequences for d1ubos_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ubos_ e.19.1.1 (S:) Nickel-iron hydrogenase, small subunit {Desulfovibrio vulgaris} lmgprrpsvvylhnaectgcsesvlrafepyidtlildtlsldyhetimaaagdaaeaal eqavnsphgfiavveggiptaangiygkvanhtmldicsrilpkaqaviaygtcatfggv qaakpnptgakgvndalkhlgvkainiagcppnpynlvgtivyylknkaapeldslnrpt mffgqtvheqcprlphfdagefapsfeseearkgwclyelgckgpvtmnncpkikfnqtn wpvdaghpcigcsepdfwdamtpfyqn
Timeline for d1ubos_: