Lineage for d1ubll_ (1ubl L:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.18: HydB/Nqo4-like [56761] (1 superfamily)
    3 domains: (1) all-alpha; (2&3) alpha+beta
  4. Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) (S)
  5. Family e.18.1.1: Nickel-iron hydrogenase, large subunit [56763] (2 proteins)
  6. Protein Nickel-iron hydrogenase, large subunit [56764] (5 species)
  7. Species Desulfovibrio vulgaris [TaxId:881] [56766] (11 PDB entries)
  8. Domain d1ubll_: 1ubl L: [88424]
    Other proteins in same PDB: d1ubls_
    complexed with cmo, f3s, fne, mg, mpd, sf4

Details for d1ubll_

PDB Entry: 1ubl (more details), 1.2 Å

PDB Description: three-dimensional structure of the carbon monoxide complex of [nife]hydrogenase from desulufovibrio vulgaris miyazaki f
PDB Compounds: (L:) Periplasmic [NiFe] hydrogenase Large subunit

SCOPe Domain Sequences for d1ubll_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ubll_ e.18.1.1 (L:) Nickel-iron hydrogenase, large subunit {Desulfovibrio vulgaris [TaxId: 881]}
ssysgpivvdpvtrieghlrievevengkvknayssstlfrgleiilkgrdprdaqhftq
rtcgvctythalastrcvdnavgvhipknatyirnlvlgaqylhdhivhfyhlhaldfvd
vtaalkadpakaakvassisprkttaadlkavqdklktfvetgqlgpftnayflgghpay
yldpetnliatahylealrlqvkaaramavfgaknphtqftvvggvtcydaltpqriaef
ealwketkafvdevyipdllvvaaaykdwtqyggtdnfitfgefpkdeydlnsrffkpgv
vfkrdfknikpfdkmqieehvrhswyegaearhpwkgqtqpkytdlhgddryswmkapry
mgepmetgplaqvliaysqghpkvkavtdavlaklgvgpealfstlgrtaargietavia
eyvgvmlqeykdniakgdnvicapwempkqaegvgfvnaprgglshwiriedgkignfql
vvpstwtlgprcdknklspveasligtpvadakrpveilrtvhsfdpciacgvh

SCOPe Domain Coordinates for d1ubll_ are not available.

Timeline for d1ubll_:

Domains from other chains:
(mouse over for more information)
d1ubls_