Lineage for d1ubkl_ (1ubk L:)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3018743Fold e.18: HydB/Nqo4-like [56761] (1 superfamily)
    3 domains: (1) all-alpha; (2&3) alpha+beta
  4. 3018744Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) (S)
  5. 3018745Family e.18.1.1: Nickel-iron hydrogenase, large subunit [56763] (2 proteins)
  6. 3018746Protein Nickel-iron hydrogenase, large subunit [56764] (5 species)
  7. 3018764Species Desulfovibrio vulgaris [TaxId:881] [56766] (11 PDB entries)
  8. 3018766Domain d1ubkl_: 1ubk L: [88422]
    Other proteins in same PDB: d1ubks_
    complexed with cmo, f3s, fne, mg, mpd, sf4

Details for d1ubkl_

PDB Entry: 1ubk (more details), 1.18 Å

PDB Description: three-dimensional structure of the carbon monoxide complex of [nife]hydrogenase from desulufovibrio vulgaris miyazaki f
PDB Compounds: (L:) Periplasmic [NiFe] hydrogenase Large subunit

SCOPe Domain Sequences for d1ubkl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ubkl_ e.18.1.1 (L:) Nickel-iron hydrogenase, large subunit {Desulfovibrio vulgaris [TaxId: 881]}
ssysgpivvdpvtrieghlrievevengkvknayssstlfrgleiilkgrdprdaqhftq
rtcgvctythalastrcvdnavgvhipknatyirnlvlgaqylhdhivhfyhlhaldfvd
vtaalkadpakaakvassisprkttaadlkavqdklktfvetgqlgpftnayflgghpay
yldpetnliatahylealrlqvkaaramavfgaknphtqftvvggvtcydaltpqriaef
ealwketkafvdevyipdllvvaaaykdwtqyggtdnfitfgefpkdeydlnsrffkpgv
vfkrdfknikpfdkmqieehvrhswyegaearhpwkgqtqpkytdlhgddryswmkapry
mgepmetgplaqvliaysqghpkvkavtdavlaklgvgpealfstlgrtaargietavia
eyvgvmlqeykdniakgdnvicapwempkqaegvgfvnaprgglshwiriedgkignfql
vvpstwtlgprcdknklspveasligtpvadakrpveilrtvhsfdpciacgvh

SCOPe Domain Coordinates for d1ubkl_:

Click to download the PDB-style file with coordinates for d1ubkl_.
(The format of our PDB-style files is described here.)

Timeline for d1ubkl_: