Lineage for d1ubjl_ (1ubj L:)

  1. Root: SCOP 1.65
  2. 338536Class e: Multi-domain proteins (alpha and beta) [56572] (38 folds)
  3. 339689Fold e.18: Nickel-iron hydrogenase, large subunit [56761] (1 superfamily)
    3 domains: (1) all-alpha; (2&3) alpha+beta
  4. 339690Superfamily e.18.1: Nickel-iron hydrogenase, large subunit [56762] (1 family) (S)
  5. 339691Family e.18.1.1: Nickel-iron hydrogenase, large subunit [56763] (1 protein)
  6. 339692Protein Nickel-iron hydrogenase, large subunit [56764] (5 species)
  7. 339709Species Desulfovibrio vulgaris [TaxId:881] [56766] (11 PDB entries)
  8. 339716Domain d1ubjl_: 1ubj L: [88420]
    Other proteins in same PDB: d1ubjs_
    complexed with cmo, fne, fs3, fs4, mg

Details for d1ubjl_

PDB Entry: 1ubj (more details), 1.35 Å

PDB Description: three-dimensional structure of the carbon monoxide complex of [nife]hydrogenase from desulufovibrio vulgaris miyazaki f

SCOP Domain Sequences for d1ubjl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ubjl_ e.18.1.1 (L:) Nickel-iron hydrogenase, large subunit {Desulfovibrio vulgaris}
ssysgpivvdpvtrieghlrievevengkvknayssstlfrgleiilkgrdprdaqhftq
rtcgvctythalastrcvdnavgvhipknatyirnlvlgaqylhdhivhfyhlhaldfvd
vtaalkadpakaakvassisprkttaadlkavqdklktfvetgqlgpftnayflgghpay
yldpetnliatahylealrlqvkaaramavfgaknphtqftvvggvtcydaltpqriaef
ealwketkafvdevyipdllvvaaaykdwtqyggtdnfitfgefpkdeydlnsrffkpgv
vfkrdfknikpfdkmqieehvrhswyegaearhpwkgqtqpkytdlhgddryswmkapry
mgepmetgplaqvliaysqghpkvkavtdavlaklgvgpealfstlgrtaargietavia
eyvgvmlqeykdniakgdnvicapwempkqaegvgfvnaprgglshwiriedgkignfql
vvpstwtlgprcdknklspveasligtpvadakrpveilrtvhsfdpciacgvh

SCOP Domain Coordinates for d1ubjl_:

Click to download the PDB-style file with coordinates for d1ubjl_.
(The format of our PDB-style files is described here.)

Timeline for d1ubjl_: